HPA001560

BCHE antibody from Sigma-Aldrich
CHE1, CHE2, E1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001560
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001560, RRID:AB_1078271
Product name
Anti-BCHE antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001560
Antibody type
Polyclonal
Antigen
Cholinesterase precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVS
LHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEAR
NRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLN
EAFVVPYGTPLSVNFGPTVD
Storage
-20C
Provider Type Product Number
- No reagents -