HPA020444

PAK5 antibody from Sigma-Aldrich
KIAA1264, PAK7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020444
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020444, RRID:AB_1854947
Product name
Anti-PAK7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020444
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase PAK 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGT
SGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTS
PQPTMRQRSRSGSGLQEPMMPFGASAFKTHPQGHS
YNSYTYPRLSEPTMCIPKVDYDRAQMVLSP
Storage
-20C
Provider Type Product Number
- No reagents -