Antibody data
- Product number
- HPA000835
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000835, RRID:AB_1079499
- Product name
- Anti-NPC2
- Provider product page
- Atlas Antibodies - HPA000835
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSY
SVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEP
DGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLV
VEWQLQDDKNQSLFCWEIPVQIVSH
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Pulmonary Abnormalities in Animal Models Due to Niemann-Pick Type C1 (NPC1) or C2 (NPC2) Disease
Roszell B, Tao J, Yu K, Gao L, Huang S, Ning Y, Feinstein S, Vite C, Bates S, Buratti E
PLoS ONE 2013 July;8(7)
Lung Cancer Signatures in Plasma Based on Proteome Profiling of Mouse Tumor Models
Taguchi A, Politi K, Pitteri S, Lockwood W, Faça V, Kelly-Spratt K, Wong C, Zhang Q, Chin A, Park K, Goodman G, Gazdar A, Sage J, Dinulescu D, Kucherlapati R, DePinho R, Kemp C, Varmus H, Hanash S
Cancer Cell 2011 September;20(3):289-299
Use of narrow-range peptide IEF to improve detection of lung adenocarcinoma markers in plasma and pleural effusion
Pernemalm M, De Petris L, Eriksson H, Brandén E, Koyi H, Kanter L, Lewensohn R, Lehtiö J
PROTEOMICS 2009 July;9(13):3414-3424
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in human cell line RT-4.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Western blot analysis in human cell lines U2OS and HeLa using Anti-NPC2 antibody. Corresponding NPC2 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human epididymis shows high expression.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human endometrium shows low expression as expected.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human epididymis shows strong granular cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human testis shows moderate to strong granular cytoplasmic positivity in Leydig cells and cells in seminiferous ducts.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human endometrium shows weak granular cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human epididymis and endometrium tissues using Anti-NPC2 antibody. Corresponding NPC2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human epididymis and skeletal muscle tissues using HPA000835 antibody. Corresponding NPC2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more