HPA000835

NPC2 antibody from Sigma-Aldrich
EDDM1, HE1, NP-C2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000835
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000835, RRID:AB_1079499
Product name
Anti-NPC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000835
Antibody type
Polyclonal
Antigen
Epididymal secretory protein E1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSY
SVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEP
DGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLV
VEWQLQDDKNQSLFCWEIPVQIVSH
Storage
-20C
Provider Type Product Number
- No reagents -