SAB1401531

NPC2 antibody from Sigma-Aldrich
EDDM1, HE1, NP-C2
ELISA
Recommended by provider

Antibody data

Product number
SAB1401531
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401531, RRID:AB_10609316
Product name
Monoclonal Anti-NPC2 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1401531
Antibody type
Monoclonal
Antigen
NPC2 (NP_006423, 52 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
GQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFP
IPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPS
IKLVVEWQLQDDKNQSLFCWEIPVQIVSHL*
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -