Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001509-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001509-M01, RRID:AB_425390
- Product name
- CTSD monoclonal antibody (M01), clone 3F12-1B9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant CTSD.
- Antigen sequence
LHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVV
FDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSST
YVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASS
ASALGGVKVERQVFGEATKQPGITFIAAKFDGILG
MAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSR
DPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYW
QVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPV
DEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITL
KLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDI
PPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAA
RL- Isotype
- IgG
- Antibody clone number
- 3F12-1B9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Characterization of the human gastric fluid proteome reveals distinct pH-dependent protein profiles: implications for biomarker studies.
Kam SY, Hennessy T, Chua SC, Gan CS, Philp R, Hon KK, Lai L, Chan WH, Ong HS, Wong WK, Lim KH, Ling KL, Tan HS, Tan MM, Ho M, Kon OL
Journal of proteome research 2011 Oct 7;10(10):4535-46
Journal of proteome research 2011 Oct 7;10(10):4535-46
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CTSD expression in transfected 293T cell line by CTSD monoclonal antibody (M01), clone 3F12-1B9.Lane 1: CTSD transfected lysate (Predicted MW: 44.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CTSD is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of CTSD transfected lysate using anti-CTSD monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CTSD MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CTSD on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol