HPA003001

CTSD antibody from Sigma-Aldrich
CLN10, CPSD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003001
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003001, RRID:AB_1078404
Product name
Anti-CTSD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003001
Antibody type
Polyclonal
Antigen
Cathepsin D precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTS
FDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGV
KVERQVFGEATKQPGITFIAAKFDGILGMAYPRIS
VNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPG
GELMLGGT
Storage
-20C
Provider Type Product Number
- No reagents -