HPA016807

ZDHHC17 antibody from Sigma-Aldrich
HIP14, HYPH, KIAA0946
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016807
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016807, RRID:AB_1858999
Product name
Anti-ZDHHC17 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016807
Antibody type
Polyclonal
Antigen
Palmitoyltransferase ZDHHC17 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RKEGFNTKMADGPDEYDTEAGCVPLLHPEEIKPQS
HYNHGYGEPLGRKTHIDDYSTWDIVKATQYGIYER
CRELVEAGYDVR
Storage
-20C
Provider Type Product Number
- No reagents -