HPA005960

DBH antibody from Sigma-Aldrich
DBM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005960
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005960, RRID:AB_1078628
Product name
Anti-DBH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005960
Antibody type
Polyclonal
Antigen
Dopamine beta-hydroxylase precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVY
GILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEP
ELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKG
FSRHHIIKYEPIVTKGN
Storage
-20C
Provider Type Product Number
- No reagents -