HPA027342

VEGFD antibody from Sigma-Aldrich
FIGF, VEGF-D
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027342
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027342, RRID:AB_1848597
Product name
Anti-FIGF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027342
Antibody type
Polyclonal
Antigen
Vascular endothelial growth factor D Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TGCKCLPTAPRHPYSIIRRSIQIPEEDRCSHSKKL
CPIDMLWDSNKCKCVLQEENPLAGTEDHSHLQEPA
LCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCF
ECKESLETCCQKHKLFHPDT
Storage
-20C
Provider Type Product Number
- No reagents -