H00002162-M03A

F13A1 antibody from Abnova Corporation
F13A
No application information provided.

Antibody data

Product number
H00002162-M03A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002162-M03A, RRID:AB_1204332
Product name
F13A1 monoclonal antibody (M03A), clone 4G5
Provider product page
Abnova Corporation - H00002162-M03A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant F13A1.
Antigen sequence
MSETSRTAFGGRRAVPPNNSNAAEDDLPTVELQGV
VPRGVNLQEFLNATSVHLFKERWDTNKVDHHTDKY
ENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYV
IGRYPQENKGTYIPVPIVSELQSGKWGAKIVMRED
RSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSR
NPETDTYILFNPWCEDDAVYLDNEKEREEYVLNDI
GVIFYGEVNDIKTRSWSYGQFEDGILDTCLYVMDR
AQMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSW
DNIYAYGVPPSAWTGSVDILLEYRSSENPVRYGQC
WVFAGVFNTFLRCLGIPARIVTNYFSAHDNDANLQ
MDIFLEEDGNVNSKLTKDSVWNYHCWNEAWMTRPD
LPVGFGGWQAVDSTPQENSDGMYRCGPASVQAIKH
GHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVEN
VDATHIGKLIVTKQIGGDGMMDITDTYKFQEGQEE
ERLALETALMYGAKKPLNTEGVMKSRSNVDMDFEV
ENAVLGKDFKLSITFRNNSHNRYTITAYLSANITF
YTGVPKAEFKKETFDVTLEPLSFKKEAVLIQAGEY
MGQLLEQASLHFFVTARINETRDVLAKQKSTVLTI
PEIIIKVRGTQVVGSDMTVIVEFTNPLKETLRNVW
VHLDGPGVTRPMKKMFREIRPNSTVQWEEVCRPWV
SGHRKLIASMSSDSLRHVYGELDVQIQRRPSM
Isotype
IgM
Antibody clone number
4G5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -