HPA001804

F13A1 antibody from Sigma-Aldrich
F13A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001804
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001804, RRID:AB_1078792
Product name
Anti-F13A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001804
Antibody type
Polyclonal
Antigen
Coagulation factor XIII A chain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LNVTSVHLFKERWDTNKVDHHTDKYENNKLIVRRG
QSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKG
TYIPVPIVSELQSGKWGAKIVMREDRSVRLSIQSS
PKCIVGKFRMYVAVWTPYGVLRTSRNPETDT
Storage
-20C
Provider Type Product Number
- No reagents -