HPA001610

PON1 antibody from Sigma-Aldrich
ESA, PON
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001610
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001610, RRID:AB_1079656
Product name
Anti-PON1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001610
Antibody type
Polyclonal
Antigen
Serum paraoxonase/arylesterase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVQPVELPNCNLVKGIETGSEDLEILPNGLAFISS
GLKYPGIKSFNPNSPGKILLMDLNEEDPTVLELGI
TGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDA
KSTVELFKFQEEEKSLLHLKTIRHKLLPNLNDIVA
VGPE
Storage
-20C
Provider Type Product Number
- No reagents -