Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183090 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Bromodomain Containing 9 (BRD9) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-BRD9 antibody: synthetic peptide directed towards the N terminal of human BRD9
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHA
GFKMM SKQAALLGNE- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references SS18 together with animal-specific factors defines human BAF-type SWI/SNF complexes.
The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
Fugu ESTs: new resources for transcription analysis and genome annotation.
Middeljans E, Wan X, Jansen PW, Sharma V, Stunnenberg HG, Logie C
PloS one 2012;7(3):e33834
PloS one 2012;7(3):e33834
The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A
Genome research 2003 Oct;13(10):2265-70
Genome research 2003 Oct;13(10):2265-70
Fugu ESTs: new resources for transcription analysis and genome annotation.
Clark MS, Edwards YJ, Peterson D, Clifton SW, Thompson AJ, Sasaki M, Suzuki Y, Kikuchi K, Watabe S, Kawakami K, Sugano S, Elgar G, Johnson SL
Genome research 2003 Dec;13(12):2747-53
Genome research 2003 Dec;13(12):2747-53
No comments: Submit comment
No validations: Submit validation data