HPA021465

BRD9 antibody from Sigma-Aldrich
FLJ13441
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021465
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021465, RRID:AB_1845441
Product name
Anti-BRD9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021465
Antibody type
Polyclonal
Antigen
Bromodomain-containing protein 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MGYLKRNGDGSLLYSVVNTAEPDADEEETHPVDLS
SLSSKLLPGFTTLGFKDERRNKVTFLSSATTALSM
QNNSVFGDLKSDEMELLYS
Storage
-20C
Provider Type Product Number
- No reagents -