HPA001641

RBP4 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001641
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001641, RRID:AB_1079795
Product name
Anti-RBP4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001641
Antibody type
Polyclonal
Antigen
Plasma retinol-binding protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEF
SVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDT
EDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYA
VQYSCRLLNLDGTCA
Storage
-20C
Provider Type Product Number
- No reagents -