HPA014865

ZBTB38 antibody from Sigma-Aldrich
CIBZ, FLJ35036, PPP1R171, ZNF921
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014865
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014865, RRID:AB_1858957
Product name
Anti-ZBTB38 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014865
Antibody type
Polyclonal
Antigen
Zinc finger and BTB domain-containing protein 38 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVLSLSNSSENAASVISYSGSAPSVIVHSSQFSSV
IMHSNAIAAMTSSNHRAFSDPAVSQSLKDDSKPEP
DKVGRFASRPKSIKEKKKTTSHTRGEIPEESNYVA
DPGGSLSKTTNIAEETSKIET
Storage
-20C
Provider Type Product Number
- No reagents -