Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002192-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002192-M01, RRID:AB_489969
- Product name
- FBLN1 monoclonal antibody (M01), clone 4C9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FBLN1.
- Antigen sequence
GDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGP
CKQQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNEC
ITGSHSCRLGESCINTVGSFRCQRDSSCGT- Isotype
- IgG
- Antibody clone number
- 4C9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FBLN1 monoclonal antibody (M01), clone 4C9 Western Blot analysis of FBLN1 expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FBLN1 expression in transfected 293T cell line by FBLN1 monoclonal antibody (M01), clone 4C9.Lane 1: FBLN1 transfected lysate(74.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of FBLN1 transfected lysate using anti-FBLN1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FBLN1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol