HPA001612

FBLN1 antibody from Sigma-Aldrich
FBLN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001612
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001612, RRID:AB_1078825
Product name
Anti-FBLN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001612
Antibody type
Polyclonal
Antigen
Fibulin-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQ
DALGNCIDINECLSISAPCPIGHTCINTEGSYTCQ
KNVPNCGRGYHLNEEGTRCVDVDECAPPAEPCGKG
HRCVNSPGSFRCECKTGYYFDGISRMCVDVNE
Storage
-20C
Provider Type Product Number
- No reagents -