Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003050-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003050-M01, RRID:AB_425475
- Product name
- HBZ monoclonal antibody (M01), clone 3C4-1D5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant HBZ.
- Antigen sequence
MSLTKTERTIIVSMWAKISTQADTIGTETLERLFL
SHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDA
VKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHC
LLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEK
YR- Isotype
- IgG
- Antibody clone number
- 3C4-1D5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HBZ monoclonal antibody (M01), clone 3C4-1D5 Western Blot analysis of HBZ expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of HBZ expression in transfected 293T cell line by HBZ monoclonal antibody (M01), clone 3C4-1D5.Lane 1: HBZ transfected lysate(15.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HBZ is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol