H00286097-B01

MICU3 antibody from Abnova Corporation
DKFZp313A0139, EFHA2

Antibody data

Product number
H00286097-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00286097-B01, RRID:AB_1138191
Product name
EFHA2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00286097-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human EFHA2 protein.
Antigen sequence
MAALRRLLWPPPRVSPPLCAHQPLLGPWGRPAVTT
LGLPGRPFSSREDEERAVAEAAWRRRRRWGELSVA
AAAGGGLVGLVCYQLYGDPRAGSPATGRPSKSAAT
EPEDPPRGRGMLPIPVAAAKETVAIGRTDIEDLDL
YATSRERRFRLFASIECEGQLFMTPYDFILAVTTD
EPKVAKTWKSLSKQELNQMLAETPPVWKGSSKLFR
NLKEKGVISYTEYLFLLCILTKPHAGFRIAFNMFD
TDGNEMVDKKEFLVLQEIFRKKNEKREIKGDEEKR
AMLRLQLYGYHSPTNSVLKTDAEELVSRSYWDTLR
RNTSQALFSDLAERADDITSLVTDTTLLVHFFGKK
GKAELNFEDFYRFMDNLQTEVLEIEFLSYSNGMNT
ISEEDFAHILLRYTNVENTSVFLENVRYSIPEEKG
ITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIGQ
DEFKRAVYVATGLKFSPHLVNTVFKIFDVDKDDQL
SYKEFIGIMKDRLHRGFRGYKTVQKYPTFKSCLKK
ELHSR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -