H00025983-B01P

NGDN antibody from Abnova Corporation
C14orf120, CANu1, DKFZP564O092, LCP5, lpd-2, NGD
No application information provided.

Antibody data

Product number
H00025983-B01P
Provider
Abnova Corporation
Product name
NGDN purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00025983-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human NGDN protein.
Antigen sequence
MAALGVLESDLPSAVTLLKNLQEQVMAVTAQVKSL
TQKVQAGAYPTEKGLSFLEVKDQLLLMYLMDLTHL
ILDKASGGSLQGHDAVLRLVEIRTVLEKLRPLDQK
LKYQIDKLIKTAVTGSLSENDPLRFKPHPSNMMSK
LSSEDEEEDEAEDDQSEASGKKSVKGVSKKYVPPR
LVPVHYDETEAEREKKRLERAKRRALSSSVIRELK
EQYSDAPEEIRDARHPHVTRQSQEDQHRINYEESM
MVRLSVSKREKGRRKRANVMSSQLHSLTHFSDISA
LTGGTVHLDEDQNPIKKRKKIPQKGRKKKGFRRRR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -