PAB20023

NGDN antibody from Abnova Corporation
C14orf120, CANu1, DKFZP564O092, LCP5, lpd-2, NGD

Antibody data

Product number
PAB20023
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20023, RRID:AB_10965671
Product name
NGDN polyclonal antibody
Provider product page
Abnova Corporation - PAB20023
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant NGDN.
Antigen sequence
LMYLMDLTHLILDKASGGSLQGHDAVLRLVEIRTV
LEKLRPLDQKLKYQIDKLIKTAVTGSLSENDPLRF
KPHPSNMMSKLSSEDEEEDEAEDDQSEASGKKSVK
GVSKKYVPPRLVPVHYDETEAEREKKRLERAKRRA
LSSSVIREL
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -