HPA000944

NGDN antibody from Atlas Antibodies
C14orf120, CANu1, DKFZP564O092, LCP5, lpd-2, NGD
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000944
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000944, RRID:AB_1079483
Product name
Anti-NGDN
Provider product page
Atlas Antibodies - HPA000944
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LMYLMDLTHLILDKASGGSLQGHDAVLRLVEIRTV
LEKLRPLDQKLKYQIDKLIKTAVTGSLSENDPLRF
KPHPSNMMSKLSSEDEEEDEAEDDQSEASGKKSVK
GVSKKYVPPRLVPVHYDETEAEREKKRLERAKRRA
LSSSVIREL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -