HPA000944

NGDN antibody from Sigma-Aldrich
C14orf120, CANu1, DKFZP564O092, LCP5, lpd-2, NGD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000944
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000944, RRID:AB_1079483
Product name
Anti-NGDN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000944
Antibody type
Polyclonal
Antigen
Neuroguidin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LMYLMDLTHLILDKASGGSLQGHDAVLRLVEIRTV
LEKLRPLDQKLKYQIDKLIKTAVTGSLSENDPLRF
KPHPSNMMSKLSSEDEEEDEAEDDQSEASGKKSVK
GVSKKYVPPRLVPVHYDETEAEREKKRLERAKRRA
LSSSVIREL
Storage
-20C
Provider Type Product Number
- No reagents -