Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182518 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ets Variant 4 (ETV4) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ETV4 antibody: synthetic peptide directed towards the middle region of human ETV4
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
HSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSE
PCPPY PQQSFKQEYH- Vial size
- 50 µg
Submitted references Prostate cancer ETS rearrangements switch a cell migration gene expression program from RAS/ERK to PI3K/AKT regulation.
Oncogenic ETS proteins mimic activated RAS/MAPK signaling in prostate cells.
The ETS gene ETV4 is required for anchorage-independent growth and a cell proliferation gene expression program in PC3 prostate cells.
E1AF expression levels are not associated with prognosis in human breast cancer.
Selvaraj N, Budka JA, Ferris MW, Jerde TJ, Hollenhorst PC
Molecular cancer 2014 Mar 19;13:61
Molecular cancer 2014 Mar 19;13:61
Oncogenic ETS proteins mimic activated RAS/MAPK signaling in prostate cells.
Hollenhorst PC, Ferris MW, Hull MA, Chae H, Kim S, Graves BJ
Genes & development 2011 Oct 15;25(20):2147-57
Genes & development 2011 Oct 15;25(20):2147-57
The ETS gene ETV4 is required for anchorage-independent growth and a cell proliferation gene expression program in PC3 prostate cells.
Hollenhorst PC, Paul L, Ferris MW, Graves BJ
Genes & cancer 2011 Jan 1;1(10):1044-1052
Genes & cancer 2011 Jan 1;1(10):1044-1052
E1AF expression levels are not associated with prognosis in human breast cancer.
Span PN, Manders P, Heuvel JJ, Beex LV, Sweep CG
Breast cancer research and treatment 2003 May;79(1):129-31
Breast cancer research and treatment 2003 May;79(1):129-31
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting