Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA005768 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA005768, RRID:AB_1848294
- Product name
- Anti-ETV4
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
YLGEHSSVFQQPLDICHSFTSQGGGREPLPAPYQH
QLSEPCPPYPQQSFKQEYHDPLYEQAGQPAVDQGG
VNGHRYPGAGVVIKQEQTDFAYDSDVTGCASMYLH
TEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVVPEK
FEGDIKQEGV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references A tool to facilitate clinical biomarker studies--a tissue dictionary based on the Human Protein Atlas.
Synthetic transactivation screening reveals ETV4 as broad coactivator of hypoxia-inducible factor signaling.
Kampf C, Bergman J, Oksvold P, Asplund A, Navani S, Wiking M, Lundberg E, Uhlén M, Ponten F
BMC medicine 2012 Sep 12;10:103
BMC medicine 2012 Sep 12;10:103
Synthetic transactivation screening reveals ETV4 as broad coactivator of hypoxia-inducible factor signaling.
Wollenick K, Hu J, Kristiansen G, Schraml P, Rehrauer H, Berchner-Pfannschmidt U, Fandrey J, Wenger RH, Stiehl DP
Nucleic acids research 2012 Mar;40(5):1928-43
Nucleic acids research 2012 Mar;40(5):1928-43
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong nuclear(nucleolar) positivity in neuronal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
- Sample type
- HUMAN