Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA005768 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA005768, RRID:AB_1848294
- Product name
- Anti-ETV4
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
YLGEHSSVFQQPLDICHSFTSQGGGREPLPAPYQH
QLSEPCPPYPQQSFKQEYHDPLYEQAGQPAVDQGG
VNGHRYPGAGVVIKQEQTDFAYDSDVTGCASMYLH
TEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVVPEK
FEGDIKQEGV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references ETV4 Is Necessary for Estrogen Signaling and Growth in Endometrial Cancer Cells
Synthetic transactivation screening reveals ETV4 as broad coactivator of hypoxia-inducible factor signaling
A tool to facilitate clinical biomarker studies - a tissue dictionary based on the Human Protein Atlas
Rodriguez A, Vahrenkamp J, Berrett K, Clark K, Guillen K, Scherer S, Yang C, Welm B, Janát-Amsbury M, Graves B, Gertz J
Cancer Research 2020;80(6):1234-1245
Cancer Research 2020;80(6):1234-1245
Synthetic transactivation screening reveals ETV4 as broad coactivator of hypoxia-inducible factor signaling
Wollenick K, Hu J, Kristiansen G, Schraml P, Rehrauer H, Berchner-Pfannschmidt U, Fandrey J, Wenger R, Stiehl D
Nucleic Acids Research 2012;40(5):1928-1943
Nucleic Acids Research 2012;40(5):1928-1943
A tool to facilitate clinical biomarker studies - a tissue dictionary based on the Human Protein Atlas
Kampf C, Bergman J, Oksvold P, Asplund A, Navani S, Wiking M, Lundberg E, Uhlén M, Ponten F
BMC Medicine 2012;10(1)
BMC Medicine 2012;10(1)
No comments: Submit comment
No validations: Submit validation data