HPA005768

ETV4 antibody from Sigma-Aldrich
E1A-F, E1AF, PEA3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005768
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005768, RRID:AB_1848294
Product name
Anti-ETV4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005768
Antibody type
Polyclonal
Antigen
ETS translocation variant 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YLGEHSSVFQQPLDICHSFTSQGGGREPLPAPYQH
QLSEPCPPYPQQSFKQEYHDPLYEQAGQPAVDQGG
VNGHRYPGAGVVIKQEQTDFAYDSDVTGCASMYLH
TEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVVPEK
FEGDIKQEGV
Storage
-20C
Provider Type Product Number
- No reagents -