Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183210 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Thyroid Hormone Receptor Interactor 13 (TRIP13) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TRIP13 antibody: synthetic peptide directed towards the N terminal of human TRIP13
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
KDSQPIDLSACTVALHIFQLNEDGPSSENLEEETE
NIIAA NHWVLPAAEF- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Towards a proteome-scale map of the human protein-protein interaction network.
Rual JF, Venkatesan K, Hao T, Hirozane-Kishikawa T, Dricot A, Li N, Berriz GF, Gibbons FD, Dreze M, Ayivi-Guedehoussou N, Klitgord N, Simon C, Boxem M, Milstein S, Rosenberg J, Goldberg DS, Zhang LV, Wong SL, Franklin G, Li S, Albala JS, Lim J, Fraughton C, Llamosas E, Cevik S, Bex C, Lamesch P, Sikorski RS, Vandenhaute J, Zoghbi HY, Smolyar A, Bosak S, Sequerra R, Doucette-Stamm L, Cusick ME, Hill DE, Roth FP, Vidal M
Nature 2005 Oct 20;437(7062):1173-8
Nature 2005 Oct 20;437(7062):1173-8
No comments: Submit comment
No validations: Submit validation data