HPA005727

TRIP13 antibody from Sigma-Aldrich
16E1BP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005727
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005727, RRID:AB_10603220
Product name
Anti-TRIP13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005727
Antibody type
Polyclonal
Antigen
thyroid hormone receptor interactor 13 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
STAKKEDINLSVRKLLNRHNIVFGDYTWTEFDEPF
LTRNVQSVSIIDTELKVKDSQPIDLSACTVALHIF
QLNEDGPSSENLEEETENIIAANHWVLPAAEFHGL
WDSLVYDVEVKSH
Storage
-20C
Provider Type Product Number
- No reagents -