Antibody data

Product number
PAB28455
Provider
Abnova Corporation
Product name
ALX1 polyclonal antibody
Provider product page
Abnova Corporation - PAB28455
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ALX1.
Antigen sequence
DNESFYSKASAGKCVQAFGPLPRAEHHVRLERTSP
CQDSSVNYGITKVEGQPLHTELNRAMDNCNSLRMS
PVKGMQEKGELDELGDKCDSNVSSSKKRRHRTTFT
SLQLEELEKVFQKTHYP
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -