HPA001598

ALX1 antibody from Sigma-Aldrich
CART1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001598
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001598, RRID:AB_1078400
Product name
Anti-CART1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001598
Antibody type
Polyclonal
Antigen
Cartilage homeoprotein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DNESFYSKASAGKCVQAFGPLPRAEHHVRLERTSP
CQDSSVNYGITKVEGQPLHTELNRAMDNCNSLRMS
PVKGMQEKGELDELGDKCDSNVSSSKKRRHRTTFT
SLQLEELEKVFQKTHYP
Storage
-20C
Provider Type Product Number
- No reagents -