HPA018905

ALX1 antibody from Sigma-Aldrich
CART1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018905
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018905, RRID:AB_1844783
Product name
Anti-ALX1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018905
Antibody type
Polyclonal
Antigen
ALX homeobox protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAGN
ASGGSVVTSCMLPRDTSSCMTPYSHSPRTDSSYTG
FSNHQNQFSHVPLNNFFTDSLLTGATNGHAFETKP
EFERRSSSIAVL
Storage
-20C
Provider Type Product Number
- No reagents -