HPA020061

ZCWPW1 antibody from Sigma-Aldrich
DKFZp434N0510, FLJ10057, ZCW1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020061
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020061, RRID:AB_1858989
Product name
Anti-ZCWPW1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020061
Antibody type
Polyclonal
Antigen
Zinc finger CW-type PWWP domain protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NKEECGKGPKRIFAPPAQKSYSLLPCSPNSPKEET
PGISSPETEARISLPKASLKKKEEKATMKNVPSRE
QEKKRKAQINKQA
Storage
-20C
Provider Type Product Number
- No reagents -