Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006667-M01A - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006667-M01A, RRID:AB_10658483
- Product name
- SP1 monoclonal antibody (M01A), clone 4H6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SP1.
- Antigen sequence
GTGELDLTATQLSQGANGWQIISSSSGATPTSKEQ
SGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQ
QVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATG
AQVQQ- Isotype
- IgG
- Antibody clone number
- 4H6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SP1 monoclonal antibody (M01A), clone 4H6 Western Blot analysis of SP1 expression in IMR-32 ( Cat # L008V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SP1 monoclonal antibody (M01A), clone 4H6. Western Blot analysis of SP1 expression in Hela S3 NE ( Cat # L013V3 ).