HPA001853

SP1 antibody from Atlas Antibodies
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001853
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001853, RRID:AB_1080069
Product name
Anti-SP1
Provider product page
Atlas Antibodies - HPA001853
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQT
SSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQ
TINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQL
GLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTR
REACTCP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -