HPA001853

SP1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001853
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001853, RRID:AB_1080069
Product name
Anti-SP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001853
Antibody type
Polyclonal
Antigen
Transcription factor Sp1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQT
SSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQ
TINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQL
GLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTR
REACTCP
Storage
-20C
Provider Type Product Number
- No reagents -