H00022903-B01

BTBD3 antibody from Abnova Corporation
dJ742J24.1, KIAA0952

Antibody data

Product number
H00022903-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00022903-B01, RRID:AB_1137811
Product name
BTBD3 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00022903-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human BTBD3 protein.
Antigen sequence
MVDDKEKNMKCLTFFLMLPETVKNRSKKSSKKANT
SSSSSNSSKLPPVCYEIITLKTKKKKMAADIFPRK
KPANSSSTSVQQYHQQNLSNNNLIPAPNWQGLYPT
IRERNAMMFNNDLMADVHFVVGPPGGTQRLPGHKY
VLAVGSSVFHAMFYGELAEDKDEIRIPDVEPAAFL
AMLKYIYCDEIDLAADTVLATLYAAKKYIVPHLAR
ACVNFLETSLSAKNACVLLSQSCLFEEPDLTQRCW
EVIDAQAELALKSEGFCDIDFQTLESILRRETLNA
KEIVVFEAALNWAEVECQRQDLALSIENKRKVLGK
ALYLIRIPTMALDDFANGAAQSGVLTLNETNDIFL
WYTAAKKPELQFVSKARKGLVPQRCHRFQSCAYRS
NQWRYRGRCDSIQFAVDKRVFIAGFGLYGSSCGSA
EYSAKIELKRQGVVLGQNLSKYFSDGSSNTFPVWF
EYPVQIEPDTFYTASVILDGNELSYFGQEGMTEVQ
CGKVTVQFQCSSDSTNGTGVQGGQIPELIFYA
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -