Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007023-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007023-M03, RRID:AB_566233
- Product name
- TFAP4 monoclonal antibody (M03), clone 7A10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TFAP4.
- Antigen sequence
AEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKR
RRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQL
DKERSVRMMLEEQVRSLEAHMYPEKLKVIA- Isotype
- IgG
- Antibody clone number
- 7A10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TFAP4 monoclonal antibody (M03), clone 7A10 Western Blot analysis of TFAP4 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of TFAP4 expression in transfected 293T cell line by TFAP4 monoclonal antibody (M03), clone 7A10.Lane 1: TFAP4 transfected lysate(38.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TFAP4 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to TFAP4 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol