HPA001912

TFAP4 antibody from Atlas Antibodies
AP-4, bHLHc41
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001912
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001912, RRID:AB_1080251
Product name
Anti-TFAP4
Provider product page
Atlas Antibodies - HPA001912
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLT
PETQRDQERRIRREIANSNERRRMQSINAGFQSLK
TLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLL
QQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDI
WEDEK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -