HPA001912

TFAP4 antibody from Sigma-Aldrich
AP-4, bHLHc41
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001912
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001912, RRID:AB_1080251
Product name
Anti-TFAP4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001912
Antibody type
Polyclonal
Antigen
Transcription factor AP-4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLT
PETQRDQERRIRREIANSNERRRMQSINAGFQSLK
TLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLL
QQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDI
WEDEK
Storage
-20C
Provider Type Product Number
- No reagents -