H00008233-M03

ZRSR2 antibody from Abnova Corporation
U2AF1-RS2, U2AF1L2, URP, ZC3H22

Antibody data

Product number
H00008233-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008233-M03, RRID:AB_1205152
Product name
U2AF1L2 monoclonal antibody (M03), clone 2H5
Provider product page
Abnova Corporation - H00008233-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant U2AF1L2.
Antigen sequence
GRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNF
LHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSER
RERMGHHDDYYSRLRGRRNPSPDHSYKRNG
Isotype
IgG
Antibody clone number
2H5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -