Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1107084 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-E74-Like Factor 2 (Ets Domain Transcription Factor) (ELF2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ELF2 antibody: synthetic peptide directed towards the N terminal of human ELF2.
- Description
- Purified on peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
TSPDSHEPMKKKKVGRKPKTQQSPISNGSPELGIK
KKPREGKGNTTYLWE- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Isoforms of the Ets transcription factor NERF/ELF-2 physically interact with AML1 and mediate opposing effects on AML1-mediated transcription of the B cell-specific blk gene.
Cho JY, Akbarali Y, Zerbini LF, Gu X, Boltax J, Wang Y, Oettgen P, Zhang DE, Libermann TA
The Journal of biological chemistry 2004 May 7;279(19):19512-22
The Journal of biological chemistry 2004 May 7;279(19):19512-22
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Hum. Fetal Heart; Host: Rabbit . Target Name: ELF2 . Sample Tissue: Human Fetal Heart . Antibody Dilution: 1.0ug/ml.; ELF2 antibody - N-terminal region (AP42047PU-N) in Hum. Fetal Heart cells using Western Blot
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Jurkat; WB Suggested Anti-ELF2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: Jurkat cell lysate; ELF2 antibody - N-terminal region (AP42047PU-N) in Human Jurkat cells using Western Blot