HPA006057

ELF2 antibody from Atlas Antibodies
EU32, NERF, NERF-1A, NERF-1B, NERF-2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006057
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006057, RRID:AB_1078733
Product name
Anti-ELF2
Provider product page
Atlas Antibodies - HPA006057
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MTSAVVDSGGTILELSSNGVENQEESEKVSEYPAV
IVEPVPSARLEQGYAAQVLVYDDETYMMQDVAEEQ
EVETENVETVEASVHSSNAHCTDKTIEAAEALLHM
ESPTCLRDSRSPEFIHAAMRPDVITETVVEVSTEE
SEP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -