HPA023269

NIPA1 antibody from Atlas Antibodies
MGC35570, SLC57A1, SPG6

Antibody data

Product number
HPA023269
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023269, RRID:AB_1854485
Product name
Anti-NIPA1
Provider product page
Atlas Antibodies - HPA023269
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HGPTNIMVYISICSLLGSFTVPSTKGIGLAAQDIL
HNNPSSQRA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.