HPA023269

NIPA1 antibody from Sigma-Aldrich
MGC35570, SPG6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023269
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023269, RRID:AB_1854485
Product name
Anti-NIPA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023269
Antibody type
Polyclonal
Antigen
Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HGPTNIMVYISICSLLGSFTVPSTKGIGLAAQDIL
HNNPSSQRA
Storage
-20C
Provider Type Product Number
- No reagents -