Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007704-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007704-M01, RRID:AB_489974
- Product name
- ZBTB16 monoclonal antibody (M01), clone 3A7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ZBTB16.
- Antigen sequence
QRELFSKLGELAVGMKSESRTIGEQCSVCGVELPD
NEAVEQHRKLHSGMKTYGCELCGKRFLDSLRLRMH
LLAHSAGAKAFVCDQCGAQFSKEDALETHR- Isotype
- IgG
- Antibody clone number
- 3A7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ZBTB16 expression in transfected 293T cell line by ZBTB16 monoclonal antibody (M01), clone 3A7.Lane 1: ZBTB16 transfected lysate (Predicted MW: 11.11 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ZBTB16 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between TRAF2 and ZBTB16. HeLa cells were stained with anti-TRAF2 rabbit purified polyclonal 1:1200 and anti-ZBTB16 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)