Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501728 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger and BTB Domain Containing 16 (ZBTB16) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZBTB16 antibody: synthetic peptide directed towards the C terminal of human ZBTB16
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
GASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD
WRIEK TYLYLCYV- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references An unusual haplotype structure on human chromosome 8p23 derived from the inversion polymorphism.
Redox-mediated modification of PLZF by SUMO-1 and ubiquitin.
Deng L, Zhang Y, Kang J, Liu T, Zhao H, Gao Y, Li C, Pan H, Tang X, Wang D, Niu T, Yang H, Zeng C
Human mutation 2008 Oct;29(10):1209-16
Human mutation 2008 Oct;29(10):1209-16
Redox-mediated modification of PLZF by SUMO-1 and ubiquitin.
Kang SI, Choi HW, Kim IY
Biochemical and biophysical research communications 2008 May 16;369(4):1209-14
Biochemical and biophysical research communications 2008 May 16;369(4):1209-14
No comments: Submit comment
No validations: Submit validation data