HPA001499

ZBTB16 antibody from Sigma-Aldrich
PLZF, ZNF145
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001499
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001499, RRID:AB_1079640
Product name
Anti-ZBTB16 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001499
Antibody type
Polyclonal
Antigen
Zinc finger and BTB domain-containing protein 16 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLL
YAAEILEIEYLEEQCLKMLETIQASDDNDTEATMA
DGGAEEEEDRKARYLKNIFISKHSSEESGYASVAG
QSLPGPMVDQSPSVSTSFGLSA
Storage
-20C
Provider Type Product Number
- No reagents -