Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002004-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002004-M02, RRID:AB_1137189
- Product name
- ELK3 monoclonal antibody (M02), clone 3A12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ELK3.
- Antigen sequence
SRESLLLQDSDCKASPEGREAHKHGLAALRSTSRN
EYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPP
EDSPPVEEVRTVIRFVTNKTDKHVTRPVVS- Isotype
- IgG
- Antibody clone number
- 3A12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ELK3 expression in transfected 293T cell line by ELK3 monoclonal antibody (M02), clone 3A12.Lane 1: ELK3 transfected lysate(44.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ELK3 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol