Antibody data
- Antibody Data
 - Antigen structure
 - References [0]
 - Comments [0]
 - Validations
 - Western blot [1]
 - ELISA [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - H00002004-M02 - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#H00002004-M02, RRID:AB_1137189
 - Product name
 - ELK3 monoclonal antibody (M02), clone 3A12
 - Antibody type
 - Monoclonal
 - Description
 - Mouse monoclonal antibody raised against a partial recombinant ELK3.
 - Antigen sequence
 SRESLLLQDSDCKASPEGREAHKHGLAALRSTSRN
EYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPP
EDSPPVEEVRTVIRFVTNKTDKHVTRPVVS- Isotype
 - IgG
 - Antibody clone number
 - 3A12
 - Storage
 - Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
 
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Western Blot analysis of ELK3 expression in transfected 293T cell line by ELK3 monoclonal antibody (M02), clone 3A12.Lane 1: ELK3 transfected lysate(44.2 KDa).Lane 2: Non-transfected lysate.
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Detection limit for recombinant GST tagged ELK3 is approximately 0.3ng/ml as a capture antibody.
 - Validation comment
 - Sandwich ELISA (Recombinant protein)
 - Protocol
 - Protocol